Recombinant Full Length Arabidopsis Thaliana 3-Ketoacyl-Coa Synthase 1(Kcs1) Protein, His-Tagged
Cat.No. : | RFL24239AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana 3-ketoacyl-CoA synthase 1(KCS1) Protein (Q9MAM3) (1-528aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-528) |
Form : | Lyophilized powder |
AA Sequence : | MERTNSIEMDRERLTAEMAFRDSSSAVIRIRRRLPDLLTSVKLKYVKLGLHNSCNVTTIL FFLIILPLTGTVLVQLTGLTFDTFSELWSNQAVQLDTATRLTCLVFLSFVLTLYVANRSK PVYLVDFSCYKPEDERKISVDSFLTMTEENGSFTDDTVQFQQRISNRAGLGDETYLPRGI TSTPPKLNMSEARAEAEAVMFGALDSLFEKTGIKPAEVGILIVNCSLFNPTPSLSAMIVN HYKMREDIKSYNLGGMGCSAGLISIDLANNLLKANPNSYAVVVSTENITLNWYFGNDRSM LLCNCIFRMGGAAILLSNRRQDRKKSKYSLVNVVRTHKGSDDKNYNCVYQKEDERGTIGV SLARELMSVAGDALKTNITTLGPMVLPLSEQLMFLISLVKRKMFKLKVKPYIPDFKLAFE HFCIHAGGRAVLDEVQKNLDLKDWHMEPSRMTLHRFGNTSSSSLWYEMAYTEAKGRVKAG DRLWQIAFGSGFKCNSAVWKALRPVSTEEMTGNAWAGSIDQYPVKVVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCS1 |
Synonyms | KCS1; EL1; At1g01120; T25K16.11; 3-ketoacyl-CoA synthase 1; KCS-1; Very long-chain fatty acid condensing enzyme 1; VLCFA condensing enzyme 1 |
UniProt ID | Q9MAM3 |
◆ Native Proteins | ||
Lectin-1814P | Active Native Peanut Lectin Protein, Cy3 labeled | +Inquiry |
HP-200H | Native Human Haptoglobin | +Inquiry |
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
ADA-P036B | Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine) | +Inquiry |
Lectin-1816P | Active Native Peanut Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMX-8427HCL | Recombinant Human BMX 293 Cell Lysate | +Inquiry |
Thalamus-68H | Human Thalamus Tissue Lysate | +Inquiry |
PCDHGA12-1303HCL | Recombinant Human PCDHGA12 cell lysate | +Inquiry |
LOC388882-4690HCL | Recombinant Human LOC388882 293 Cell Lysate | +Inquiry |
VGLL1-412HCL | Recombinant Human VGLL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCS1 Products
Required fields are marked with *
My Review for All KCS1 Products
Required fields are marked with *
0
Inquiry Basket