Recombinant Full Length Arabidopsis Thaliana 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase 2(Hmg2) Protein, His-Tagged
Cat.No. : | RFL34637AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2(HMG2) Protein (P43256) (1-562aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-562) |
Form : | Lyophilized powder |
AA Sequence : | MEDLRRRFPTKKNGEEISNVAVDPPLRKASDALPLPLYLTNTFFLSLFFATVYFLLSRWR EKIRNSTPLHVVDLSEICALIGFVASFIYLLGFCGIDLIFRSSSDDDVWVNDGMIPCNQS LDCREVLPIKPNSVDPPRESELDSVEDEEIVKLVIDGTIPSYSLETKLGDCKRAAAIRRE AVQRITGKSLTGLPLEGFDYNSILGQCCEMPVGYVQIPVGIAGPLLLDGVEYSVPMATTE GCLVASTNRGFKAIHLSGGAFSVLVKDAMTRAPVVRFPSARRAALVMFYLQDPSNFERLS LIFNKSSRFARLQSITCTIAGRNLYPRFACSTGDAMGMNMVSKGVQNVLDFVKSEFPDMD VIGISGNYCSDKKASAVNWIEGRGKHVVCEAFIKAEIVEKVLKTSVEALVELNTLKNLVG SAMAGSLGGFNAHSSNIVSAVFIATGQDPAQNVESSHCMTMILPDGDDLHISVSMPCIEV GTVGGGTQLASQAACLNLLGVKGSNNEKPGSNAQQLARIVAGSVLAGELSLMSAIAAGQL VKSHMKYNRSSRDIGPSSQVNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HMG2 |
Synonyms | HMG2; HMGR2; At2g17370; F5J6.24; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2; AtHMGR2; HMG-CoA reductase 2 |
UniProt ID | P43256 |
◆ Recombinant Proteins | ||
MPIG6B-0122H | Recombinant Human MPIG6B Protein, GST-Tagged | +Inquiry |
ADIPOR1-285H | Recombinant Human ADIPOR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPC6-1403H | Recombinant Human GPC6 Protein (24-529 aa), His-tagged | +Inquiry |
RFL35307MF | Recombinant Full Length Macaca Mulatta Macoilin(Tmem57) Protein, His-Tagged | +Inquiry |
DINB-1605B | Recombinant Bacillus subtilis DINB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Fga -67R | Native Rat Fibrinogen | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
IgG-165R | Native Rabbit IgG Fc fragment | +Inquiry |
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
Collagen-315B | Native Bovine Collagen Type III | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRX1-3796HCL | Recombinant Human NLRX1 293 Cell Lysate | +Inquiry |
ZNF697-2078HCL | Recombinant Human ZNF697 cell lysate | +Inquiry |
TPBG-852HCL | Recombinant Human TPBG 293 Cell Lysate | +Inquiry |
CCL21-552HCL | Recombinant Human CCL21 cell lysate | +Inquiry |
SAYSD1-7979HCL | Recombinant Human C6orf64 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMG2 Products
Required fields are marked with *
My Review for All HMG2 Products
Required fields are marked with *
0
Inquiry Basket