Recombinant Full Length Arabidopsis Lyrata Subsp. Lyrata Casp-Like Protein Aralydraft_470341 (Aralydraft_470341) Protein, His-Tagged
Cat.No. : | RFL23279AF |
Product Overview : | Recombinant Full Length Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_470341 (ARALYDRAFT_470341) Protein (D7KCH2) (1-164aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-164) |
Form : | Lyophilized powder |
AA Sequence : | MVKLTQRLGGLVLRFAAFCAALGAVIAMITSRERSSFFVISLVAKYSDLAAFKYFVIANA IVTVYSFLVLFLPKESLLWKFVVVLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPIC GQVPRFCDQITGALIAGLVALVLYVFLLIFSIHHVVDPFLLRKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ARALYDRAFT_470341 |
Synonyms | ARALYDRAFT_470341; CASP-like protein 1C2; AlCASPL1C2 |
UniProt ID | D7KCH2 |
◆ Recombinant Proteins | ||
CARS-10724H | Recombinant Human CARS, His-tagged | +Inquiry |
Sgsh-713M | Active Recombinant Mouse Sgsh Protein, His-tagged | +Inquiry |
CASP3-1333H | Recombinant Human CASP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADCK3-170R | Recombinant Rat ADCK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EBI3-504H | Active Recombinant Human Epstein-Barr Virus Induced 3 | +Inquiry |
◆ Native Proteins | ||
ELANE-001H | Active Native Human ELANE Protein | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
Thrombin-21H | Active Native Cattle Thrombin | +Inquiry |
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
C-type lectin like protein-040H | Native Hen C-type lectin like protein Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PMVK-3084HCL | Recombinant Human PMVK 293 Cell Lysate | +Inquiry |
SLC2A6-1739HCL | Recombinant Human SLC2A6 293 Cell Lysate | +Inquiry |
ARRDC1-8678HCL | Recombinant Human ARRDC1 293 Cell Lysate | +Inquiry |
RNH1-2269HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
Liver-282H | Human Liver Cytoplasmic Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARALYDRAFT_470341 Products
Required fields are marked with *
My Review for All ARALYDRAFT_470341 Products
Required fields are marked with *
0
Inquiry Basket