Recombinant Full Length Aquifex Aeolicus Uncharacterized Protein Aq_359 (Aq_359) Protein, His-Tagged
Cat.No. : | RFL31860AF |
Product Overview : | Recombinant Full Length Aquifex aeolicus Uncharacterized protein aq_359 (aq_359) Protein (O66685) (1-356aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aquifex Aeolicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-356) |
Form : | Lyophilized powder |
AA Sequence : | MLLDRYLLSRFLGIFLNVSFVSVLLVSLYALLDFLVGFKEKRTDVALSYFLNILPLGFYY ISFITLSISLILFLRKVFEKKMELTVQSFGISPLRFSLPVLLFSVFLSSTFLLGNEYAFP KLLGNLWFIEKNYKKKQEVKGFIKNFWFIKKENEVKTYYHVGNLNLSDGSLFNFYTMKVE RKNLNPLEVLKVFSGVWKDKEIFIRSGEIYDFEKGKREKVFNKTFKLGLSIKEVELFSEK IDFLSLSEIFFLMQKSKKVGLNVDVYTGELFYRVMFSLSPVFISIFSLYLFFKHKVLSQV IPRFLVFIVILWLVILSPKILPQKANQPVLYSLIPIFLLILYSLKGVYDLRKGFRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aq_359 |
Synonyms | aq_359; Uncharacterized protein aq_359 |
UniProt ID | O66685 |
◆ Recombinant Proteins | ||
ACBD3-99R | Recombinant Rat ACBD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd276-41RAF555 | Recombinant Rat Cd276 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CRYAA-26991TH | Recombinant Human CRYAA, His-tagged | +Inquiry |
RFL14859EF | Recombinant Full Length Escherichia Coli Maltose Transport System Permease Protein Malg(Malg) Protein, His-Tagged | +Inquiry |
RPRD2-7767M | Recombinant Mouse RPRD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ATF-177D | Native Dog Apotransferrin | +Inquiry |
Prothrombin-58M | Native Mouse Prothrombin | +Inquiry |
UO-44 | Active Native Urate oxidase | +Inquiry |
Collagen-120B | Native Bovine Type I Collagen, FITC-tagged | +Inquiry |
TRPM2-8463H | Native Human TRPM2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLIG3-1249HCL | Recombinant Human OLIG3 cell lysate | +Inquiry |
Cerebellum-507D | Dog Cerebellum Lysate, Total Protein | +Inquiry |
CPNE8-7307HCL | Recombinant Human CPNE8 293 Cell Lysate | +Inquiry |
TRIM4-777HCL | Recombinant Human TRIM4 293 Cell Lysate | +Inquiry |
HL-60-044HCL | Human HL-60 Cell Nuclear Extract | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aq_359 Products
Required fields are marked with *
My Review for All aq_359 Products
Required fields are marked with *
0
Inquiry Basket