Recombinant Full Length Antiholin-Like Protein Lrgb(Lrgb) Protein, His-Tagged
Cat.No. : | RFL25201BF |
Product Overview : | Recombinant Full Length Antiholin-like protein LrgB(lrgB) Protein (Q81JL5) (1-230aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus anthracis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-230) |
Form : | Lyophilized powder |
AA Sequence : | MASTMTPYFGIVVSLIAYGIGTLLFKHSKGFFLFTPLFVAMVLGIVFLKVGNFTFEEYNT GGKMISFFLEPATIAFAIPLYKQVDKLKKYWWQILSAIVVGSICSVIVVFIVAKAIGLDT AVMNSMLPQAATTAIALPISESIGGIPAITSFAVIFNAVIVYALGALFLKTFRVKHPIAK GLALGTAGHALGVAVGIEMGEVEAAMASIAVTVVGVVTVVVIPMFMPFIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lrgB |
Synonyms | lrgB; BA_5689; GBAA_5689; BAS5293; Antiholin-like protein LrgB |
UniProt ID | Q81JL5 |
◆ Native Proteins | ||
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
IgG-347G | Native Guinea Pig Gamma Globulin Fraction | +Inquiry |
TIMP1-92H | Native Human TIMP-1 | +Inquiry |
C8-103H | Native Human C8 Protein | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF398-2021HCL | Recombinant Human ZNF398 cell lysate | +Inquiry |
Eye-136R | Rat Eye Tissue Lysate | +Inquiry |
NLGN1-1564MCL | Recombinant Mouse NLGN1 cell lysate | +Inquiry |
ATF4-8630HCL | Recombinant Human ATF4 293 Cell Lysate | +Inquiry |
LINC00851-4335HCL | Recombinant Human MGC44328 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lrgB Products
Required fields are marked with *
My Review for All lrgB Products
Required fields are marked with *
0
Inquiry Basket