Recombinant Full Length Anthoceros Formosae Photosystem I Assembly Protein Ycf4(Ycf4) Protein, His-Tagged
Cat.No. : | RFL13655AF |
Product Overview : | Recombinant Full Length Anthoceros formosae Photosystem I assembly protein Ycf4(ycf4) Protein (Q85BP9) (1-184aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anthoceros formosae (Hornwort) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-184) |
Form : | Lyophilized powder |
AA Sequence : | MNWESEWFRIELIRGSRRISNFFWAFILLSGALGFLSVGLSSYFGKDLISFLSYEQIVFI PQGIVMCFYGIAGSAFSLYLWGTIFWNIGSGYNKFDKGKGIVCIYRWGFPGKNRRIRIEF SMKDIEAIGMEVQEGFYPRRTLRLKIKGQQDVPLTYIGENLTLREIEEEAAELARFLQIS IEGF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ycf4 |
Synonyms | ycf4; Photosystem I assembly protein Ycf4 |
UniProt ID | Q85BP9 |
◆ Recombinant Proteins | ||
Tacstd2-6273M | Recombinant Mouse Tacstd2 Protein, Myc/DDK-tagged | +Inquiry |
HLA-A&B2M&Survivin-333H | Recombinant Human HLA-A*02:01&B2M&Survivin (LMLGEFLKL) Tetramer protein, His-Avi-tagged, Biotinylated | +Inquiry |
TRMT6-3517Z | Recombinant Zebrafish TRMT6 | +Inquiry |
SLC3A1-5196R | Recombinant Rat SLC3A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YAF2-5234R | Recombinant Rhesus monkey YAF2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1807M | Active Native Maackia Amurensis Lectin I Protein, Biotinylated | +Inquiry |
Lipoproteins-13H | Natve Human Lipoproteins, Very Low Density | +Inquiry |
B. afzelii-21 | Native Borrelia afzelii Antigen | +Inquiry |
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
TF-132B | Native Bovine Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMF1-4714HCL | Recombinant Human LMF1 293 Cell Lysate | +Inquiry |
MAN1B1-4526HCL | Recombinant Human MAN1B1 293 Cell Lysate | +Inquiry |
DNASE1L1-6867HCL | Recombinant Human DNASE1L1 293 Cell Lysate | +Inquiry |
CLCN5-7473HCL | Recombinant Human CLCN5 293 Cell Lysate | +Inquiry |
LILRB3-2208HCL | Recombinant Human LILRB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ycf4 Products
Required fields are marked with *
My Review for All ycf4 Products
Required fields are marked with *
0
Inquiry Basket