Recombinant Full Length Aneurinibacillus Migulanus Sensor Protein Gtcs(Gtcs) Protein, His-Tagged
Cat.No. : | RFL16617AF |
Product Overview : | Recombinant Full Length Aneurinibacillus migulanus Sensor protein gtcS(gtcS) Protein (Q44930) (1-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aneurinibacillus migulanus (Bacillus migulanus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-370) |
Form : | Lyophilized powder |
AA Sequence : | MITAYILFTVTVGVTNSIVFYLDDHIGTRHFKKRVYCSSAWIVAWRLMEMVIFALSVYLY SRWTSKRITGPLEKITDAIQKMREGEFAQRLCFKADYELTLIQEHFNEMVAHLEKTEAEK NKLEQSKQRMLLDLSHDFKTPITTIQGYAMALQMGVVDSPEKQRRYLEMIYNKSIIVTAL VEDMFQLATLDSPDLPSAEEHGRFGRTGSEIAIAYFDQFEQNKFSLDLKIPTQRVMIRMN RNLLYRALSNLLSNTLKHNPKGTKVALSLTDTHEAILLEVMDNGIGIAEELKESIFQPFV RGDKARTGEGTGLGLPSPKKRLNFMVESCCSRVNQGKQYSRSFSQRLENDLPYRLPYHRM NKFHRNANQQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gtcS |
Synonyms | gtcS; Sensor protein GtcS |
UniProt ID | Q44930 |
◆ Recombinant Proteins | ||
NR2F1-01H | Recombinant Human NR2F1 Protein, Myc/DDK-tagged | +Inquiry |
RFL32358PF | Recombinant Full Length Pseudomonas Putida Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
TTR-3950H | Recombinant Human TTR protein, His-tagged | +Inquiry |
PPIB-4260R | Recombinant Rat PPIB Protein, His (Fc)-Avi-tagged | +Inquiry |
Lztfl1-3886M | Recombinant Mouse Lztfl1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
LH-838H | Active Native Human Luteinizing Hormone | +Inquiry |
GG-190H | Native Horse Gamma Globulin protein | +Inquiry |
IgG-119S | Native Sheep Immunoglobulin G | +Inquiry |
ALPL-5324H | Active Native Human Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF170-1521HCL | Recombinant Human RNF170 cell lysate | +Inquiry |
GABRA3-6065HCL | Recombinant Human GABRA3 293 Cell Lysate | +Inquiry |
TMEM143-1000HCL | Recombinant Human TMEM143 293 Cell Lysate | +Inquiry |
MRPS34-4136HCL | Recombinant Human MRPS34 293 Cell Lysate | +Inquiry |
Skeletal Muscle-428H | Hamster Skeletal Muscle Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gtcS Products
Required fields are marked with *
My Review for All gtcS Products
Required fields are marked with *
0
Inquiry Basket