Recombinant Full Length Anaeromyxobacter Sp. Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged
Cat.No. : | RFL15764AF |
Product Overview : | Recombinant Full Length Anaeromyxobacter sp. Lipoprotein signal peptidase(lspA) Protein (A7H688) (1-211aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anaeromyxobacter sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-211) |
Form : | Lyophilized powder |
AA Sequence : | MSARRPFSKWALLALLFVTLVAIDQWTKYLAVERLTTLFERTGAETLGERLAGFLEHQHL EPISTDPYYVWRPVWRMNYVENPGAAWGLFRGHSEAFRNGFFTLVSLGAVAFILHYYRKL RAEQRYLQVALALVLSGAVGNFLDRLARGYVIDFIEWYWWNRPDIRWPTFNIADSLIVVG VALLVLHPGSGKAAQKAGADAEGDRRASTGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lspA |
Synonyms | lspA; Anae109_0014; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II |
UniProt ID | A7H688 |
◆ Recombinant Proteins | ||
HDC-495H | Recombinant Human HDC Protein, His-tagged | +Inquiry |
COL2A1-7926R | Recombinant Rabbit COL2A1 protein, His & GST-tagged | +Inquiry |
CENPE-1114H | Recombinant Human CENPE Protein, GST-Tagged | +Inquiry |
E2F1-2016H | Recombinant Human E2F1 Protein (Val88-Phe437), N-His tagged | +Inquiry |
CNTN1-1597H | Recombinant Human Contactin 1 | +Inquiry |
◆ Native Proteins | ||
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
Thrombin-28B | Active Native Bovine alpha-Thrombin-DFP | +Inquiry |
FGG-53S | Native Sheep Fibrinogen | +Inquiry |
LDL-247H | Native Human Lipoproteins, Very Low Density | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
AWAT1-8556HCL | Recombinant Human AWAT1 293 Cell Lysate | +Inquiry |
UBE2D4-583HCL | Recombinant Human UBE2D4 293 Cell Lysate | +Inquiry |
CILP-7494HCL | Recombinant Human CILP 293 Cell Lysate | +Inquiry |
Fetal Umbilical Cord-179H | Human Fetal Umbilical Cord Lysate | +Inquiry |
DDI1-452HCL | Recombinant Human DDI1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lspA Products
Required fields are marked with *
My Review for All lspA Products
Required fields are marked with *
0
Inquiry Basket