Recombinant Full Length Anaeromyxobacter Dehalogenans Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL23750AF |
Product Overview : | Recombinant Full Length Anaeromyxobacter dehalogenans Undecaprenyl-diphosphatase(uppP) Protein (B8J8T6) (1-292aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anaeromyxobacter dehalogenans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-292) |
Form : | Lyophilized powder |
AA Sequence : | MSLVSAALFGLLQALTEFLPVSSTAHLLVFGELLGHSLDDRRFRAFVTIIQAGTTLAVLV YFRADIARLVAAAARGLARGRPFGTPEARLGWYIVLGTVPAALAGKLLEHRIEALGNWVI AGSLVALGLVLLAAERLASHRRRVEDVGAGDALLIGVAQALALVPGSSRSGTTITGGMLL GFTREAAARFSFLLSVPITLAAGAYKLWSTVPDLRGEAAWTVATVVGTVVSAVAGYLVID WLLAWLRTRTTYVFVVWRLAAGAAIAALILSGVLPAGAEAPPPPPPALHAAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; A2cp1_0175; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | B8J8T6 |
◆ Recombinant Proteins | ||
FTMT-6072M | Recombinant Mouse FTMT Protein | +Inquiry |
CCDC6-1349M | Recombinant Mouse CCDC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28435RF | Recombinant Full Length Nodulation Protein J(Nodj) Protein, His-Tagged | +Inquiry |
BMPR1A-2678H | Active Recombinant Human BMPR1A protein, hFc&His-tagged | +Inquiry |
PANK1-1520H | Recombinant Human PANK1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CRP-4303H | Native Human C-reactive Protein | +Inquiry |
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
LH-9389B | Active Native Bovine LH Protein | +Inquiry |
IgA-251G | Native Goat Immunoglobulin A | +Inquiry |
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM123-1790HCL | Recombinant Human TMEM123 cell lysate | +Inquiry |
COG5-7384HCL | Recombinant Human COG5 293 Cell Lysate | +Inquiry |
Liver-859R | Mini Rabbit Liver Membrane Lysate, Total Protein | +Inquiry |
RGS19-2379HCL | Recombinant Human RGS19 293 Cell Lysate | +Inquiry |
EPHA4-2136MCL | Recombinant Mouse EPHA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket