Recombinant Full Length Anaeromyxobacter Dehalogenans Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged
Cat.No. : | RFL26578AF |
Product Overview : | Recombinant Full Length Anaeromyxobacter dehalogenans Large-conductance mechanosensitive channel(mscL) Protein (B8J6V0) (1-140aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anaeromyxobacter dehalogenans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-140) |
Form : | Lyophilized powder |
AA Sequence : | MSFASEFKAFALKGNVVDLAVGVIIGAAFGKIVDSIVNDLVMPVVGAIFGGFDFKDYFVA LKEIPPGVPHALDAVKKAGVPVFAYGSFLTIVLNFLILAFIIFLMVKQFNRMKRAEPAPA PAAPPEQVVLLREIRDALRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mscL |
Synonyms | mscL; A2cp1_3746; Large-conductance mechanosensitive channel |
UniProt ID | B8J6V0 |
◆ Recombinant Proteins | ||
GCM1-13196H | Recombinant Human GCM1, His-tagged | +Inquiry |
TNMD-2255H | Recombinant Human TNMD Protein, MYC/DDK-tagged | +Inquiry |
ns2-4561V | Recombinant BCoV-ENT(strain 98TXSF-110-ENT) ns2 protein(1-278aa), His-tagged | +Inquiry |
AP3M1-657H | Recombinant Human AP3M1 protein, GST-tagged | +Inquiry |
MRPS36-5623H | Recombinant Human MRPS36 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Bilirubin-156P | Native Porcine Bilirubin | +Inquiry |
CPB-01P | Native Porcine Carboxypeptidase B | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
F2R-27H | Native Human F2R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2A1-762HCL | Recombinant Human GTF2A1 cell lysate | +Inquiry |
OR2H1-3563HCL | Recombinant Human OR2H1 293 Cell Lysate | +Inquiry |
EPHB1-579MCL | Recombinant Mouse EPHB1 cell lysate | +Inquiry |
SMPX-1653HCL | Recombinant Human SMPX 293 Cell Lysate | +Inquiry |
KEL-4990HCL | Recombinant Human KEL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mscL Products
Required fields are marked with *
My Review for All mscL Products
Required fields are marked with *
0
Inquiry Basket