Recombinant Full Length Anabaena Variabilis Photosystem Q(B) Protein 6(Psba5) Protein, His-Tagged
Cat.No. : | RFL24381AF |
Product Overview : | Recombinant Full Length Anabaena variabilis Photosystem Q(B) protein 6(psbA5) Protein (Q3M5L6) (1-356aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anabaena variabilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-356) |
Form : | Lyophilized powder |
AA Sequence : | MSTIVQRQKEFNFFDLWDSFCAWITSTENRIYIGWFGVLSIPTLLAATTCFVLAFIAAPS VDMDGIREPIMGSLMDGNNLITAAVVPTSAAIGLHFYPIWEAASMDEWLYNGGPYQLIVL HFLIGIWCLLGRFWELSYRLGMRPWIAVAYSAPVIAATSVLLVYPIGQGSFSDGLPLGIA GTFHFMLAFQGDHNILMHPFHMLGVAGVFGGALLSSLHGSLVASTLIRNTDENESINGGY KLGQQQVTYKYLAGHNSFLGRLLIPTFASRNHRAFHFLLAALPTIGIWFAAMGVCSMAFN LNGLNFNHSILDSRGNVIRSDADILNRANIGLSVMHAPNVHNFPLVLSSGQPIPVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbA6 |
Synonyms | psbA6; Ava_4121; Photosystem II protein D1 4; PSII D1 protein 4; Photosystem II Q(B protein 4 |
UniProt ID | Q3M5L6 |
◆ Native Proteins | ||
Lectin-1763A | Active Native Agaricus bisporus lectin Protein, Agarose bound | +Inquiry |
B. afzelii-21 | Native Borrelia afzelii Antigen | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
PIV1-18 | Native Parainfluenza Virus Type 1 Antigen | +Inquiry |
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC9A3R2-1693HCL | Recombinant Human SLC9A3R2 293 Cell Lysate | +Inquiry |
HMBOX1-5485HCL | Recombinant Human HMBOX1 293 Cell Lysate | +Inquiry |
MTF1-4085HCL | Recombinant Human MTF1 293 Cell Lysate | +Inquiry |
CCNG2-7706HCL | Recombinant Human CCNG2 293 Cell Lysate | +Inquiry |
ZNF649-754HCL | Recombinant Human ZNF649 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbA6 Products
Required fields are marked with *
My Review for All psbA6 Products
Required fields are marked with *
0
Inquiry Basket