Recombinant Full Length Amphidinium Operculatum Cytochrome B6(Petb) Protein, His-Tagged
Cat.No. : | RFL33289AF |
Product Overview : | Recombinant Full Length Amphidinium operculatum Cytochrome b6(petB) Protein (Q8WHC6) (1-219aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Amphidinium operculatum (Dinoflagellate) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-219) |
Form : | Lyophilized powder |
AA Sequence : | MGFIYDWCEERLELQSIADDILSKFVPSHVNIFYCFGGIVLTCFIIQAATGFAMTLYYRP NVVEALSSVTYITNEVSFGWLVRSIHRTSSGLMVLVLLLHVSRVYLTAGFKKPRELTWIS GVILAICTVSFGVTGYSLPWDQVGYWACKIVTATPEALNNVFPSLGTVFVTLLVGGTSVG QPTXTRFYQAHTFILPLVTLALLLTHFLMIRKQGISGPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petB |
Synonyms | petB; Cytochrome b6 |
UniProt ID | Q8WHC6 |
◆ Recombinant Proteins | ||
RFX5-001H | Recombinant Human RFX5 protein, His-tagged | +Inquiry |
HPX-754H | Recombinant Human HPX protein(Met 1-His 462), His-tagged | +Inquiry |
FCER2-319H | Recombinant Human FCER2 Protein, DDK-tagged | +Inquiry |
ITPKA-2641H | Recombinant Human ITPKA Protein, MYC/DDK-tagged | +Inquiry |
MYOC-2307Z | Recombinant Zebrafish MYOC | +Inquiry |
◆ Native Proteins | ||
Cry2Ab-37B | Native Bacillus thuringiensis Cry2Ab Protein | +Inquiry |
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
Lectin-1850U | Active Native Ulex Europaeus Agglutinin I Protein, Biotinylated | +Inquiry |
IGF2-29116TH | Native Human IGF2 | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITM2C-5114HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
ADAMTS5-9028HCL | Recombinant Human ADAMTS5 293 Cell Lysate | +Inquiry |
CHMP4B-186HCL | Recombinant Human CHMP4B lysate | +Inquiry |
MARCH10-4475HCL | Recombinant Human MARCH10 293 Cell Lysate | +Inquiry |
MRPS12-4152HCL | Recombinant Human MRPS12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All petB Products
Required fields are marked with *
My Review for All petB Products
Required fields are marked with *
0
Inquiry Basket