Recombinant Full Length Amphidinium Carterae Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged
Cat.No. : | RFL22682AF |
Product Overview : | Recombinant Full Length Amphidinium carterae Cytochrome b6-f complex subunit 4(petD) Protein (Q1HCL0) (1-157aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Amphidinium carterae (Dinoflagellate) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-157) |
Form : | Lyophilized powder |
AA Sequence : | MVVRLPYVKGSILCSALAKGCGHNYYGEPAWPNDILYIFPVVILGTISFSLGLGVIENQA IGEPANPFATPLEILPEWYFFPTFNLLRILPDKLVGVLSLASVPVILVLTAFIENINRYQ NPFRRPVASLVYLTSTCYALWLGYGSVLGISEALPFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petD |
Synonyms | petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide |
UniProt ID | Q1HCL0 |
◆ Recombinant Proteins | ||
NMI-28771TH | Recombinant Human NMI, His-tagged | +Inquiry |
SERPINB10-6459C | Recombinant Chicken SERPINB10 | +Inquiry |
DPP6-304H | Recombinant Human DPP6 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD248-3581H | Recombinant Human CD248 Protein (Gly30-Cys156), C-His tagged | +Inquiry |
RFL2314MF | Recombinant Full Length Mouse Olfactory Receptor 490(Olfr490) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
ELANE-001H | Active Native Human ELANE Protein | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
FTL-26944TH | Native Human FTL | +Inquiry |
CSK-27872TH | Native Human CSK | +Inquiry |
◆ Cell & Tissue Lysates | ||
UNC5CL-1887HCL | Recombinant Human UNC5CL cell lysate | +Inquiry |
RPS27A-2165HCL | Recombinant Human RPS27A 293 Cell Lysate | +Inquiry |
OSBPL3-3537HCL | Recombinant Human OSBPL3 293 Cell Lysate | +Inquiry |
CRLF3-7274HCL | Recombinant Human CRLF3 293 Cell Lysate | +Inquiry |
EFNA5-1574RCL | Recombinant Rat EFNA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All petD Products
Required fields are marked with *
My Review for All petD Products
Required fields are marked with *
0
Inquiry Basket