Recombinant Full Length Alpha-Hemolysin Translocation Atp-Binding Protein Hlyb(Hlyb) Protein, His-Tagged
Cat.No. : | RFL14432EF |
Product Overview : | Recombinant Full Length Alpha-hemolysin translocation ATP-binding protein HlyB(hlyB) Protein (P10089) (1-707aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-707) |
Form : | Lyophilized powder |
AA Sequence : | MDSCHKIDYGLYALEILAQYHNVSVNPEEIKHRFDTDGTGLGLTSWLLAAKSLELKVKQV KKTIDRLNFISLPALVWREDGCHFILTKVSKEANRYLIFDLEQRNPRVLEQSEFEALYQG HIILIASRSSVTGKLAKFDFTWFIPAIIKYRKIFIETLVVSVFLQLFALITPLFFQVVMD KVLVHRGFSTLNVITVALSVVVVFEIILSGLRTYIFAHSTSRIDVELGAKLFRHLLALPI SYFESRRVGDTVARVRELDQIRNFLTGQALTSVLDLLFSFIFFAVMWYYSPKLTLVILFS LPCYAAWSVFISPILRRRLDDKFSRNADNQSFLVESVTAINTIKAMAVSPQMTNIWDKQL AGYVAAGFKVTVLATIGQQGIQLIQKTVMIINLWLGAHLVISGDLSIGQLIAFNMLAGQI VAPVIRLAQIWQDFQQVGISVTRLGDVLNSPTESYHGKLALPEINGDITFRNIRFRYKPD SPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNW LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVG EQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIII AHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hlyB |
Synonyms | hlyB; Alpha-hemolysin translocation ATP-binding protein HlyB |
UniProt ID | P10089 |
◆ Recombinant Proteins | ||
Csf3-5616M | Active Recombinant Mouse Colony Stimulating Factor 3 (granulocyte), His-tagged | +Inquiry |
TTC38-4263H | Recombinant Human TTC38 Protein, GST-tagged | +Inquiry |
MSMB-5661H | Recombinant Human MSMB Protein, GST-tagged | +Inquiry |
SERBP1-4989R | Recombinant Rat SERBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ager-653M | Recombinant Mouse Ager protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
FG-116H | Native Human Fibrinogen | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
PLAU -15H | Native Human HMW urokinase, HRP conjugate | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC41A3-1714HCL | Recombinant Human SLC41A3 293 Cell Lysate | +Inquiry |
LINC00303-8176HCL | Recombinant Human C1orf157 293 Cell Lysate | +Inquiry |
ZNF503-2041HCL | Recombinant Human ZNF503 cell lysate | +Inquiry |
BHLHB9-169HCL | Recombinant Human BHLHB9 cell lysate | +Inquiry |
MYL1-4031HCL | Recombinant Human MYL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All hlyB Products
Required fields are marked with *
My Review for All hlyB Products
Required fields are marked with *
0
Inquiry Basket