Recombinant Full Length Aliivibrio Salmonicida Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL20790AF |
Product Overview : | Recombinant Full Length Aliivibrio salmonicida Membrane protein insertase YidC(yidC) Protein (B6EP40) (1-541aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aliivibrio salmonicida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-541) |
Form : | Lyophilized powder |
AA Sequence : | MDTQRNILLLALALVSFLLFQQWQVETNPQQPATVSTVQQTHKNGDVPTSSTANSDAPVD SAQSDKLITITTDVLTLKVDTLGGDIIESVLNKYDAELDSKAKFVLLKNDADHSYIAQSG LIGPQGIDSNTGRAQFTAKKTDYVLADGQNELRIPLTLEKNGITYTKTLIVKRDSYAIDV EYTVNNQSSAPATVEMYANLKQNLLDDGGSLTMPTYRGGAYSTEDTRYKKYSFDDMEDKN LSIDMTNGQGWAGMLQHYFASAWIPRNVNDATLTTRVAGDYGYIGVRMPSVTIPAGQEDT LTATLWTGPKLQPQMAATAKYLDLSVDYGWLWFIASPLHKLLSFIQSIVGNWGLAIMILT FIVRGAMYPLTKAQYTSMAKMRMLQPKLAAMRERIGDDRQRMSQEMMELYKKEKVNPLGG CLPIVLQMPIFISLYWALMESVELRHAPFFGWITDLSAQDPYYILPLLMGASMFLIQKMS PTTVTDPMQQKIMTFIPVMFTVFFLWFPAGLVLYWLVSNVVTLIQQTLIYRALEKKGLHS K |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; VSAL_I0003; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B6EP40 |
◆ Recombinant Proteins | ||
SLC32A1-8326M | Recombinant Mouse SLC32A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VSIG10-5869Z | Recombinant Zebrafish VSIG10 | +Inquiry |
FTH1-569H | Recombinant Human FTH1 Protein (Met1-Ser183) | +Inquiry |
RFL32451HF | Recombinant Full Length Human Solute Carrier Family 25 Member 42(Slc25A42) Protein, His-Tagged | +Inquiry |
HS6ST1B-5059Z | Recombinant Zebrafish HS6ST1B | +Inquiry |
◆ Native Proteins | ||
ACTB-325H | Active Native Human ACTB | +Inquiry |
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
CPA-01B | Native Bovine Pancreas Carboxypeptidase A, Type II-PMSF treated | +Inquiry |
Lectin-1852U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 649 labeled | +Inquiry |
PGK-100Y | Active Native Yeast 3-Phosphoglyceric Phosphokinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBX10-1205HCL | Recombinant Human TBX10 293 Cell Lysate | +Inquiry |
RAB11FIP1-2136HCL | Recombinant Human RAB11FIP1 cell lysate | +Inquiry |
PTPN7-2681HCL | Recombinant Human PTPN7 293 Cell Lysate | +Inquiry |
L3MBTL1-964HCL | Recombinant Human L3MBTL1 cell lysate | +Inquiry |
RHBDD2-2364HCL | Recombinant Human RHBDD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket