Recombinant Full Length Alcanivorax Borkumensis Upf0761 Membrane Protein Abo_1543(Abo_1543) Protein, His-Tagged
Cat.No. : | RFL14609AF |
Product Overview : | Recombinant Full Length Alcanivorax borkumensis UPF0761 membrane protein ABO_1543(ABO_1543) Protein (Q0VPA7) (1-429aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Alcanivorax borkumensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-429) |
Form : | Lyophilized powder |
AA Sequence : | MENEQPVIPVQARFNSIKAFFVLLVRQFNEDGCRQSAAALTYTTLFAIVPVMTVSFVVLS SVPALQGKSAQLQEWAFEYFVPSAGNMLLDHLQSFAKQATNLTVLGIVFLVVTSVLMLST VEQTLNRIWKVQTPRKGLVSLLMYWALLSLGPICLGLGLAITSYLTSQAIFSDTVSYLGG VRLWLAVLPFLFTTAMLTLMYTVVPNTTVPFRQGVLGAAMAALLFELAKGAFTFFIKQAP SYQVVYGAFAAVPVFLLWIYISWTIVLGGAELVRALVVFQEHQRQVPRMHALVRLLNVFW QRQQSGKVLRSKEIRQVMQESGISQWDEFRNLLVNANLIRRTDEGGYILSRDLRNISLGQ LVAMLPWPAHTQLRVRQQPESLPWEQALKSRMDEAREGMMAPLDISLDALFSAPSAEKER HPEQQGRND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABO_1543 |
Synonyms | ABO_1543; UPF0761 membrane protein ABO_1543 |
UniProt ID | Q0VPA7 |
◆ Recombinant Proteins | ||
Slc30a6-527M | Recombinant Mouse Slc30a6 Protein, His-tagged | +Inquiry |
Mamdc4-3551M | Recombinant Mouse Mamdc4, His-tagged | +Inquiry |
RFL16354BF | Recombinant Full Length Bovine Adp-Ribosylation Factor-Like Protein 6-Interacting Protein 6(Arl6Ip6) Protein, His-Tagged | +Inquiry |
SCO2301-1454S | Recombinant Streptomyces coelicolor A3(2) SCO2301 protein, His-tagged | +Inquiry |
AMBP-129C | Recombinant Cattle AMBP Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Histone-53C | Native Calf Histone Protein | +Inquiry |
C1q-07R | Native Rat C1q Protein | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF189-1991HCL | Recombinant Human ZNF189 cell lysate | +Inquiry |
TRAP1-811HCL | Recombinant Human TRAP1 293 Cell Lysate | +Inquiry |
Spleen-528D | Dog Spleen Lysate, Total Protein | +Inquiry |
ARHGAP9-114HCL | Recombinant Human ARHGAP9 cell lysate | +Inquiry |
IFNA4-1412RCL | Recombinant Rat IFNA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ABO_1543 Products
Required fields are marked with *
My Review for All ABO_1543 Products
Required fields are marked with *
0
Inquiry Basket