Recombinant Full Length Ajellomyces Capsulata Assembly Factor Cbp4(Cbp4) Protein, His-Tagged
Cat.No. : | RFL6757AF |
Product Overview : | Recombinant Full Length Ajellomyces capsulata Assembly factor CBP4(CBP4) Protein (A6R620) (1-116aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ajellomyces capsulatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-116) |
Form : | Lyophilized powder |
AA Sequence : | MPRIGTTVKMIVAGVLLCIGGPALVQYVRPTEEELFQKFNPELQKRNLETRDQRQKDFDS FVTQLKTHAKSDKSIWHAIKESETTNRREVETRRKAELEEAERQKAQIRKELAEGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBP4 |
Synonyms | CBP4; HCAG_05078; Assembly factor CBP4; Cytochrome b mRNA-processing protein 4 |
UniProt ID | A6R620 |
◆ Recombinant Proteins | ||
SEPT5-5249H | Recombinant Human SEPT5 Protein, GST/His-tagged | +Inquiry |
FAXC-2280R | Recombinant Rat FAXC Protein | +Inquiry |
LALBA-4410H | Recombinant Human LALBA Protein (Lys20-Lys141), N-His tagged | +Inquiry |
SH-RS02240-5662S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS02240 protein, His-tagged | +Inquiry |
YIPF3-6628R | Recombinant Rat YIPF3 Protein | +Inquiry |
◆ Native Proteins | ||
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPCD-6839HCL | Recombinant Human DPCD 293 Cell Lysate | +Inquiry |
C9orf16-7939HCL | Recombinant Human C9orf16 293 Cell Lysate | +Inquiry |
TUBA3FP-1089HCL | Recombinant Human TUBA3FP cell lysate | +Inquiry |
NRN1-489HCL | Recombinant Human NRN1 cell lysate | +Inquiry |
S100A16-2091HCL | Recombinant Human S100A16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CBP4 Products
Required fields are marked with *
My Review for All CBP4 Products
Required fields are marked with *
0
Inquiry Basket