Recombinant Full Length Agrobacterium Vitis Upf0283 Membrane Protein Avi_2471 (Avi_2471) Protein, His-Tagged
Cat.No. : | RFL34518AF |
Product Overview : | Recombinant Full Length Agrobacterium vitis UPF0283 membrane protein Avi_2471 (Avi_2471) Protein (B9JWY6) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium vitis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MSKAPEDQRPMPRRPAAFSLEEPSSSPARPPFAEAQEPQRRAPKSFDANVTITPDAEDPF LAGLSEDEAILPIARPAKRRFSFGKLAGAAFGALASFAIGLWIDDLIRDLFTRADWLGYT ALTLLGIGLLALTVVVIRELAGIYRLNAVQAIKQRASALSLQGTASEARKLVKDVEDLTQ HRAETARGRSVLKAAENDIIDAPHLIALAERELLAPLDAKARSLIINASKRVSVVTAVSP RALVDLAYVLFEVVRLVRAMAELYGGRPGSIGMLRLLRDVFAHLAVTGSIAIGDGLAQQV LGHGLASRLSARLGEGVINGLMTARIGIAAMDLCRPLEFKALRRPGIGDFMPALKPAINP DSKAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Avi_2471 |
Synonyms | Avi_2471; UPF0283 membrane protein Avi_2471 |
UniProt ID | B9JWY6 |
◆ Recombinant Proteins | ||
TMEM184C-5799R | Recombinant Rat TMEM184C Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL4-134H | Recombinant Human CCL4, Fc-tagged | +Inquiry |
SUMO1-567H | Active Recombinant Human SUMO1 | +Inquiry |
TWF2-3493H | Recombinant Human TWF2, GST-tagged | +Inquiry |
RFL32304NF | Recombinant Full Length Uncharacterized Protein Orf2 Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
MMP9-29698TH | Native Human MMP9 | +Inquiry |
VZV-05 | Native Varicella Zoster Virus (VZV) Glycoprotein Antigen | +Inquiry |
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
COL2A1-1648H | Native Human COL2A1 Protein | +Inquiry |
Lectin-1866W | Active Native Succinylated Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Intestine-782D | Dog Intestine Membrane Lysate, Total Protein | +Inquiry |
PGCP-3258HCL | Recombinant Human PGCP 293 Cell Lysate | +Inquiry |
SFTPC-1896HCL | Recombinant Human SFTPC 293 Cell Lysate | +Inquiry |
DEDD-6995HCL | Recombinant Human DEDD 293 Cell Lysate | +Inquiry |
G6PD-6080HCL | Recombinant Human G6PD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Avi_2471 Products
Required fields are marked with *
My Review for All Avi_2471 Products
Required fields are marked with *
0
Inquiry Basket