Recombinant Full Length Agrobacterium Tumefaciens Probable Intracellular Septation Protein A(Atu2692) Protein, His-Tagged
Cat.No. : | RFL24198AF |
Product Overview : | Recombinant Full Length Agrobacterium tumefaciens Probable intracellular septation protein A(Atu2692) Protein (Q8UC06) (1-204aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium Fabrum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-204) |
Form : | Lyophilized powder |
AA Sequence : | MVAEISPLLKFVLELGPLMVFFFANSRGEWLASTFPVLTEFGGPIFIATGLFMIATATAL TVSWILTRKLPIMPLISGIVVFVFGALTLWLQNDTFIKMKPTIVNTLFGVILLGGLFFGQ SLLGYVFNSAFKLTDEGWRKLTLRWGVFFLFLAVLNEVVWRMFTTDTWVAFKVWGTMPIT IIFTMAQMPFVMRHSVEPLGKDEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Atu2692 |
Synonyms | yciB; Atu2692; AGR_C_4880.1; Inner membrane-spanning protein YciB |
UniProt ID | Q8UC06 |
◆ Recombinant Proteins | ||
ACAA2-1316H | Recombinant Human ACAA2 Protein (17-397 aa), His-tagged | +Inquiry |
CDK2AP2-467H | Recombinant Human CDK2AP2 Protein, His-tagged | +Inquiry |
CDH6-3691H | Recombinant Human CDH6 protein, GST-tagged | +Inquiry |
SLC6A9-5572R | Recombinant Rat SLC6A9 Protein | +Inquiry |
Spike-1588V | Recombinant SARS-COV-2 Spike RBD (Delta B.1.617.2) protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
FLNA-170C | Active Native chicken FLNA | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
DENV2-01DCL | Native DENV2 Lysate | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf86-7922HCL | Recombinant Human C9orf86 293 Cell Lysate | +Inquiry |
Placenta-384H | Human Placenta Cytoplasmic Lysate | +Inquiry |
Lung-30H | Human Lung Tissue Lysate | +Inquiry |
ABR-9122HCL | Recombinant Human ABR 293 Cell Lysate | +Inquiry |
JUNB-886HCL | Recombinant Human JUNB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Atu2692 Products
Required fields are marked with *
My Review for All Atu2692 Products
Required fields are marked with *
0
Inquiry Basket