Recombinant Full Length Agrobacterium Tumefaciens Beta-(1-->2)Glucan Export Atp-Binding/Permease Protein Ndva Protein, His-Tagged
Cat.No. : | RFL16073AF |
Product Overview : | Recombinant Full Length Agrobacterium tumefaciens Beta-(1-->2)glucan export ATP-binding/permease protein NdvA Protein (P0A2V0) (1-588aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium Fabrum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-588) |
Form : | Lyophilized powder |
AA Sequence : | MTLFQVYTRALRYLTVHKWRVAVVVIANVILAAITIAEPVLFGRIIDAISSGTNVTPILI LWAGFGVFNTVAYVAVAREADRLAHGRRATLLTEAFGRIISMPLSWHHLRGTSNALHTLL RASETLFGLWLEFMRTHLATFVALVLLIPTAMAMDLRLSFVLIGLGIVYWFIGKWVMGRT KDGQASVEEHYHSVFAHVSDSISNVSVLHSYNRIEAETKALKSFTEKLLSAQYPVLDWWA FASALNRTASTVSMMIILVIGTVLVKNGELRVGDVIAFIGFANLLIGRLDQMRQFVTQIF EARAKLEDFFVLEDAVKEREEPGDARELSNVSGTVEFRNINFGFANTKQGVHDVSFTAKA GETVAIVGPTGAGKTTLINLLQRVYDPDSGQILIDGTDISTVTKNSLRNSIATVFQDAGL LNRSIRENIRLGRETATDAEVVEAAAAAAATDFIDSRINGYLTQVGERGNRLSGGERQRI AIARAILKNAPILVLDEATSALDVETEARVKAAVDALRKNRTTFIIAHRLSTVRDADLVL FLDQGRIIEKGTFDELTQRGGRFTSLLRTSGLLTEDEGQQPRPKAIAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndvA |
Synonyms | ndvA; chvA; Atu2728; AGR_C_4944; Beta-(1-->2glucan export ATP-binding/permease protein NdvA; Attachment protein |
UniProt ID | P0A2V0 |
◆ Recombinant Proteins | ||
Cbfb-590M | Recombinant Mouse Cbfb Protein, His-tagged | +Inquiry |
TOP2A-199H | Recombinant Human TOP2A | +Inquiry |
RFL8716MF | Recombinant Full Length Multidrug Resistance Protein Mmr(Mmr) Protein, His-Tagged | +Inquiry |
EDIL3-3053H | Recombinant Human EDIL3 Protein, GST-tagged | +Inquiry |
RFL26963BF | Recombinant Full Length Bat Coronavirus 133/2005 Envelope Small Membrane Protein(E) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
GPT-26879TH | Native Human GPT | +Inquiry |
LTF-27590TH | Native Human LTF | +Inquiry |
ALB-108C | Native Cynomolgus Monkey Albumin | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC7A11-1698HCL | Recombinant Human SLC7A11 293 Cell Lysate | +Inquiry |
Kidney-563M | MiniPig Kidney Lysate, Total Protein | +Inquiry |
ZNF200-125HCL | Recombinant Human ZNF200 293 Cell Lysate | +Inquiry |
MEOX2-4365HCL | Recombinant Human MEOX2 293 Cell Lysate | +Inquiry |
HIST1H2AC-5548HCL | Recombinant Human HIST1H2AC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndvA Products
Required fields are marked with *
My Review for All ndvA Products
Required fields are marked with *
0
Inquiry Basket