Recombinant Full Length Agrobacterium Radiobacter Upf0283 Membrane Protein Arad_2632 (Arad_2632) Protein, His-Tagged
Cat.No. : | RFL21651AF |
Product Overview : | Recombinant Full Length Agrobacterium radiobacter UPF0283 membrane protein Arad_2632 (Arad_2632) Protein (B9JFT7) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium radiobacter |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MTKPTEDDPKGISRRPAAFSLEQEASREGAHTKTTAETPRRKPQSFDTEIVLTPDEEDPF LNPALTASDAEAAIAAPRRRRFSFGKVALSAFGILVSLAFGLWTDELIRNLFSRADWLGY TALTVLAIGILAVLAIVVRETAGMMRLAAVQTIKAEADAAVVETRPARAKALVQRLCTLL EANPATAKGRATLKAAEDDIIDAPHLIDLAERELLGPLDRSARVLILGASKRVSVVTAVS PRALVDILYVLYESAKLVRAMAELYGGRPGGLGMLKLMRDVLAHLAVTGSIAVGDSIVQQ LIGHGLASKLSARLGEGVVNGMMTARIGIAAMDLCRPLSFKALKRPGIGDFVGDLAPNIT GR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Arad_2632 |
Synonyms | Arad_2632; UPF0283 membrane protein Arad_2632 |
UniProt ID | B9JFT7 |
◆ Recombinant Proteins | ||
Zp2-7942R | Recombinant Rat Zp2 protein, His & T7-tagged | +Inquiry |
DCAF7-10423Z | Recombinant Zebrafish DCAF7 | +Inquiry |
ANGPT2-530C | Recombinant Cattle ANGPT2 protein, His-tagged | +Inquiry |
ADAMTS4-162R | Recombinant Rat ADAMTS4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32584HF | Recombinant Full Length Huperzia Lucidula Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HSV1-15 | Native Herpes Simplex Virus (HSV) Type 1 Antigen | +Inquiry |
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
ALB-316B | Native Bovine Albumin Protein, Biotinylated | +Inquiry |
BSI-B4-851 | Active Native Bandeiraea simplicifolia Isolectin B4 protein, biotin-conjugated | +Inquiry |
ALB-5363B | Native Bovine Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPCPD1-5810HCL | Recombinant Human GPCPD1 293 Cell Lysate | +Inquiry |
Jurkat-010HCL | Human Jurkat Whole Cell Lysate | +Inquiry |
EPHB4-2128MCL | Recombinant Mouse EPHB4 cell lysate | +Inquiry |
Colon-81H | Human Colon Liver Cirrhosis Lysate | +Inquiry |
HA-2346HCL | Recombinant H1N2 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Arad_2632 Products
Required fields are marked with *
My Review for All Arad_2632 Products
Required fields are marked with *
0
Inquiry Basket