Recombinant Full Length Aedes Aegypti Cytochrome C Oxidase Subunit 2(Coii) Protein, His-Tagged
Cat.No. : | RFL34553AF |
Product Overview : | Recombinant Full Length Aedes aegypti Cytochrome c oxidase subunit 2(COII) Protein (P50692) (1-228aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aedes Aegypti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-228) |
Form : | Lyophilized powder |
AA Sequence : | MATWANLGLQNSSSPLMEQLNFFHDHTLLILIMITVMIAYIMFMLFFNKFTNRYLLHGQT IEIIWTILPAIILMFIAFPSLRLLYLMDEINSPLITLKVIGHQWYWSYEYSNFLNLEFDS YMIPTNELDLNGFRLLDVDNRIILPMNNQIRILVTATDVLHSWTVPSLGVKIDATPGRLN QTNFLINQPGLFFGQCSEICGANHSFMPIVVESIPMNYFIKWISSQMN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COII |
Synonyms | COII; COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II |
UniProt ID | P50692 |
◆ Native Proteins | ||
APOC2-27332TH | Native Human APOC2 | +Inquiry |
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
Fga-299M | Active Native Mouse Fibrinogen | +Inquiry |
MOMP-02C | Native C. trachomatis MOMP Antigen | +Inquiry |
FGG -44D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSMO1-575HCL | Recombinant Human MSMO1 lysate | +Inquiry |
Testis-515R | Rat Testis Membrane Lysate | +Inquiry |
B3GALTL-1103HCL | Recombinant Human B3GALTL cell lysate | +Inquiry |
PTTG1IP-1444HCL | Recombinant Human PTTG1IP cell lysate | +Inquiry |
NOTCH1-469MCL | Recombinant Mouse NOTCH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COII Products
Required fields are marked with *
My Review for All COII Products
Required fields are marked with *
0
Inquiry Basket