Recombinant Full Length Adiantum Capillus-Veneris Apocytochrome F(Peta) Protein, His-Tagged
Cat.No. : | RFL12608AF |
Product Overview : | Recombinant Full Length Adiantum capillus-veneris Apocytochrome f(petA) Protein (Q85FK9) (36-321aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Adiantum capillus-veneris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (36-321) |
Form : | Lyophilized powder |
AA Sequence : | YPIFAQQNYENPREATGRIVCANCHLAKKTVDLEAPQSVLPDTVFEAIVKIPYDTRIKQV LANGKKGGLNVGAVLILPEGFELAPPNRIPTELKNKLGKLSFQTYRPGEKNIIVVGPVPG KLYSEIIFPVLSPDPGTNKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYTASATGKIK RITRKEGKGGYEIIIEESSGGREAIDVVPPGPELIVSEGEFVKADQPLTNNPNVGGFGQG EVEIVLQDPRRIQGLLAFFASVVLAQIFLVLKKKQFEKVQLAEMNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petA |
Synonyms | petA; Cytochrome f |
UniProt ID | Q85FK9 |
◆ Recombinant Proteins | ||
DNAJC12-1905R | Recombinant Rat DNAJC12 Protein | +Inquiry |
EIF4A2-233C | Recombinant Cynomolgus Monkey EIF4A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MME-2610R | Recombinant Rhesus Macaque MME Protein, His (Fc)-Avi-tagged | +Inquiry |
CSK-925M | Active Recombinant Mouse CSK Protein, GST & His-tagged | +Inquiry |
CHRNA5-1665M | Recombinant Mouse CHRNA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HBA2-27787TH | Native Human HBA2 | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
GPD-189R | Active Native Rabbit Glycerol-3-phosphate dehydrogenase | +Inquiry |
SHBG-5519H | Native Human Sex Hormone-Binding Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RDX-2433HCL | Recombinant Human RDX 293 Cell Lysate | +Inquiry |
C11orf57-8342HCL | Recombinant Human C11orf57 293 Cell Lysate | +Inquiry |
HA-915HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
NANOS2-2131HCL | Recombinant Human NANOS2 cell lysate | +Inquiry |
PDE8A-3339HCL | Recombinant Human PDE8A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All petA Products
Required fields are marked with *
My Review for All petA Products
Required fields are marked with *
0
Inquiry Basket