Recombinant Full Length Actinobacillus Pleuropneumoniae Serotype 5B Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged
Cat.No. : | RFL14257AF |
Product Overview : | Recombinant Full Length Actinobacillus pleuropneumoniae serotype 5b Electron transport complex protein RnfA(rnfA) Protein (A3MYN7) (1-193aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Actinobacillus pleuropneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-193) |
Form : | Lyophilized powder |
AA Sequence : | MVDYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVE TYVLIPLEAQFLRTLVFILVIAVIVQLTEMIVHKTSPTLYRLLGIYLPLITTNCAVLGVA LLNVNLSNNLVESVLYGFGAALGFSLVLVLFAALRERLAAADVPRPFQGASIALITAGLM SLAFMGFTGLVKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rnfA |
Synonyms | rnfA; APL_0165; Ion-translocating oxidoreductase complex subunit A; Rnf electron transport complex subunit A |
UniProt ID | A3MYN7 |
◆ Recombinant Proteins | ||
NES-6590C | Recombinant Chicken NES | +Inquiry |
RFL33025RF | Recombinant Full Length Rat Vang-Like Protein 2(Vangl2) Protein, His-Tagged | +Inquiry |
FBLN7-3134M | Recombinant Mouse FBLN7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TTLL9-6006R | Recombinant Rat TTLL9 Protein, His (Fc)-Avi-tagged | +Inquiry |
EVA1BA-5501Z | Recombinant Zebrafish EVA1BA | +Inquiry |
◆ Native Proteins | ||
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
Lysozyme-073H | Native Human Lysozyme Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTRHD1-112HCL | Recombinant Human PTRHD1 lysate | +Inquiry |
CLEC18C-7453HCL | Recombinant Human CLEC18C 293 Cell Lysate | +Inquiry |
SNX19-1661HCL | Recombinant Human SNX19 cell lysate | +Inquiry |
STARD7-1420HCL | Recombinant Human STARD7 293 Cell Lysate | +Inquiry |
FKBP4-6205HCL | Recombinant Human FKBP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rnfA Products
Required fields are marked with *
My Review for All rnfA Products
Required fields are marked with *
0
Inquiry Basket