Recombinant Full Length Acorus Calamus Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL36370AF |
Product Overview : | Recombinant Full Length Acorus calamus NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q3V4X9) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acorus calamus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MIIATTEIQAINSFSRSESLSLKEVYGLIWLLVPIFTLILVIIIGVLVIVWLEREISAGI QQRIGPEYAGPLGILQALADGTKLLFKEDLLPSRGDISLFSLGPSIAVISTLLSYLVIPF GYHLVLADLSIGVFLWIAISSIAPIGLLMSGYGSNNKYSFSGGLRAAAQSISYEIPLTLC VLSISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFLVFLVSSLAECERLPFDLPEAEE ELVAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYIFIPELFGKNKTG GIFGMTIGILITLAKAYLFLFISIATRWTLPRLRIDQLLNLGWKFLLPISLGNLLLTTSS QLVSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q3V4X9 |
◆ Native Proteins | ||
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
IgG-219H | Native Human Immunoglobulin G | +Inquiry |
CA 19-9-378H | Active Native Human Cancer Antigen 19-9 | +Inquiry |
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
Lectin-1816P | Active Native Peanut Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAD2L1-4570HCL | Recombinant Human MAD2L1 293 Cell Lysate | +Inquiry |
ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
UFSP1-518HCL | Recombinant Human UFSP1 293 Cell Lysate | +Inquiry |
MAGEB10-4547HCL | Recombinant Human MAGEB10 293 Cell Lysate | +Inquiry |
Kidney-102M | Mouse Kidney Tissue Lysate (14 Days Old) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket