Recombinant Full Length Acinetobacter Sp. Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged
Cat.No. : | RFL17430AF |
Product Overview : | Recombinant Full Length Acinetobacter sp. NADH-quinone oxidoreductase subunit K(nuoK) Protein (Q6FE62) (1-102aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acinetobacter Baylyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-102) |
Form : | Lyophilized powder |
AA Sequence : | MGNIPLEHGLIVATILFALGFYGVMVRRNLLFMLMSLEIMMNAAALAFVLAGSVWAQPDG QIMFILILTLAAAEACIGLAIVLQFYHRFHHLDVDAASEMRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nuoK |
Synonyms | nuoK; ACIAD0740; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K |
UniProt ID | Q6FE62 |
◆ Recombinant Proteins | ||
SAP050A-010-2672S | Recombinant Staphylococcus aureus (strain: NE 3874) SAP050A_010 protein, His-tagged | +Inquiry |
MARK3-4278H | Recombinant Human MARK3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDK14-180H | Recombinant Human CDK14, GST-tagged | +Inquiry |
MARVELD3-10816Z | Recombinant Zebrafish MARVELD3 | +Inquiry |
VP35-4533M | Recombinant Marburg virus (strain Kenya/Musoke/1980) VP35 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F2-5402P | Native Porcine Coagulation Factor II (thrombin) | +Inquiry |
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
Troponin C-085B | Native Bovine Troponin C Protein, Sepharose CL 4B attached | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
VTI1A-001HCL | Recombinant Human VTI1A cell lysate | +Inquiry |
CNBP-7414HCL | Recombinant Human CNBP 293 Cell Lysate | +Inquiry |
TUBGCP4-1862HCL | Recombinant Human TUBGCP4 cell lysate | +Inquiry |
CORO2B-7340HCL | Recombinant Human CORO2B 293 Cell Lysate | +Inquiry |
USP7-671HCL | Recombinant Human USP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nuoK Products
Required fields are marked with *
My Review for All nuoK Products
Required fields are marked with *
0
Inquiry Basket