Recombinant Full Length Acinetobacter Baylyi Alkane 1-Monooxygenase(Alkb) Protein, His-Tagged
Cat.No. : | RFL35796AF |
Product Overview : | Recombinant Full Length Acinetobacter baylyi Alkane 1-monooxygenase(alkB) Protein (O31250) (1-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acinetobacter Baylyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-408) |
Form : | Lyophilized powder |
AA Sequence : | MNAPVHVDQNFEEVINAARSMREIDRKRYLWMISPALPVIGIGILAGYQFSPRPIKKIFA LGGPIVLHIIIPVIDTIIGKDASNPTSEEIKQLENDPYYARLVKSFIPLQYIANVYACYL VSRKKTSFIDKILLGISMGAINGIAVNTAHELSHKADRLDHILSHLALVPTGYNHFRIEH PYGHHKRAATPEDPASSQMGETFYEFWPRTVFGSLKSAIEIETHRLKRKGKKFWSKDNEL LQGWGMSAAFHSSIIAIFGKGTIPYLVTQAFYGISLFEIINYIEHYGLKRQKRADGNYER TMPEHSWNNNNIVTNLFLYQLQRHSDHHAYPTRPFQALRHFDEAPELPSGYASMLLPAMI PPLWFKMMDKRVFEHYKEDLTKANIYPKRRAKILAKFGLTDPNIENGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | alkB |
Synonyms | alkB; alkM; ACIAD1411; Alkane 1-monooxygenase; Alkane hydroxylase; AHs; Terminal alkane hydroxylase |
UniProt ID | O31250 |
◆ Recombinant Proteins | ||
PIP4K2B-6331H | Recombinant Human PIP4K2B protein, His-tagged | +Inquiry |
DCTN6-1022R | Recombinant Rhesus Macaque DCTN6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLK3-1113R | Recombinant Rat CLK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SIRPA-0701M | Active Recombinant Mouse SIRPA protein, His-Avi-tagged, Biotinylated | +Inquiry |
CSTF1-11650H | Recombinant Human CSTF1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
TF-132B | Native Bovine Transferrin | +Inquiry |
LRP1-87H | Native Human Lipoproteins | +Inquiry |
Collagen-315B | Native Bovine Collagen Type III | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NODAL-3771HCL | Recombinant Human NODAL 293 Cell Lysate | +Inquiry |
LGI1-4759HCL | Recombinant Human LGI1 293 Cell Lysate | +Inquiry |
PGC-1705RCL | Recombinant Rat PGC cell lysate | +Inquiry |
HAS3-5632HCL | Recombinant Human HAS3 293 Cell Lysate | +Inquiry |
PPIL2-2967HCL | Recombinant Human PPIL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All alkB Products
Required fields are marked with *
My Review for All alkB Products
Required fields are marked with *
0
Inquiry Basket