Recombinant Full Length Acidianus Two-Tailed Virus Putative Transmembrane Protein Orf710 Protein, His-Tagged
Cat.No. : | RFL7538AF |
Product Overview : | Recombinant Full Length Acidianus two-tailed virus Putative transmembrane protein ORF710 Protein (Q3V4Q5) (34-710aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | ATV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (34-710) |
Form : | Lyophilized powder |
AA Sequence : | TVSSQNQVPIQIIYNYNVSGGVIYTAPLNIPSGFYNYYMINQYGTLLYSYLFSTNPAFVV WYEPQPTTETYYFVYGQSVTSQLVSTDVFSLYTQFYIYNSSMWNISNGVVSGGVLTLNGK NSILTENYTAPRYTSALWLYQILSPQSVSPTQIVYTSPIPPGSLIIVHVLTYTGSYQVPY PAIAQYNTPYIIAESYTSQYLTANSTHYYYYYNSLKYVGSMQQSLPFITTVSTNGLIFYS SAKNSQVLLPGATLPATSYTTNSTFIAGQLVGTGIDSYSINPSFVWCPEWIVNGSIQLLN GCKVPITGHYQLDKSTYAVILNSVFNSSDDELIAPVNSIVTVTYSNGTSYSFTVTGSSIY SGLPVPLVVVKFYGVGVTGIHISTNAFGINQQYSALIGFTDLLHTYGVLIQNGEAYSYIA GTKGPALGNVTFPMVVAVGEFAVGNTYYVFGEIVTTSRVFPFIQQSSYAIQPTIAYVNYN GTIPLVIQSVAETLSTGTYYELSGIAAMNVGQPTPINSVILSVVSQPGLEIVGSNGNVYS TIVQNTSAPNLVLVGFQGYSITLVYTNVQQNLVVTTNNFPVNLPSDMPLLVAIDQASRSI TITVGQTQTQSIFMKTIPVNTTTPAVSLPIPNYPGNIIVDPESELTVISYYIIGAVAIVS MAYGTKIWIGVFIFAIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Acidianus two-tailed virus Putative transmembrane protein ORF710 |
Synonyms | Putative transmembrane protein ORF710 |
UniProt ID | Q3V4Q5 |
◆ Recombinant Proteins | ||
MCTS1-11297Z | Recombinant Zebrafish MCTS1 | +Inquiry |
GZMC-7412M | Recombinant Mouse GZMC Protein | +Inquiry |
JUND-2804R | Recombinant Rat JUND Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL29773LF | Recombinant Full Length Lactobacillus Plantarum Membrane Protein Insertase Yidc 1(Yidc1) Protein, His-Tagged | +Inquiry |
Spike-723V | Active Recombinant COVID-19 Spike Trimer protein(BA.2.12.1/Omicron), His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
FGA-42D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
Amylase-64H | Active Native Human Amylase, alpha | +Inquiry |
IgG-7437M | Native Mouse IgG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V0D2-8587HCL | Recombinant Human ATP6V0D2 293 Cell Lysate | +Inquiry |
HOMER1-806HCL | Recombinant Human HOMER1 cell lysate | +Inquiry |
Spleen-477H | Human Spleen Membrane Tumor Lysate | +Inquiry |
CPT1A-7300HCL | Recombinant Human CPT1A 293 Cell Lysate | +Inquiry |
ABCF1-7HCL | Recombinant Human ABCF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Acidianus two-tailed virus Putative transmembrane protein ORF710 Products
Required fields are marked with *
My Review for All Acidianus two-tailed virus Putative transmembrane protein ORF710 Products
Required fields are marked with *
0
Inquiry Basket