Recombinant Full Length Acanthamoeba Polyphaga Mimivirus Uncharacterized Protein R710(Mimi_R710) Protein, His-Tagged
Cat.No. : | RFL15498AF |
Product Overview : | Recombinant Full Length Acanthamoeba polyphaga mimivirus Uncharacterized protein R710(MIMI_R710) Protein (Q5UQ56) (1-194aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | APMV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-194) |
Form : | Lyophilized powder |
AA Sequence : | MSWHTGSNQDNKLFPKGKLSGSYAPLDIAFENSPAMNEFENRLCHNNPIISERSMSPAVS ASYSNPEATSCGCMQTQTQPQHQTLSQHLPQTHHTDAHDQQKLSGIFYNRTTDAQNQFSE TINPPPSYTVHNTDIRIPLNRQQQYPANHLGSELLEGYNNVGTEPCMGFWEILLLIILIA VLVYGIYWLYKSEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIMI_R710 |
Synonyms | MIMI_R710; Uncharacterized protein R710 |
UniProt ID | Q5UQ56 |
◆ Recombinant Proteins | ||
FABP5-2064P | Recombinant Pig FABP5 protein, His & T7-tagged | +Inquiry |
TXLNB-9782M | Recombinant Mouse TXLNB Protein, His (Fc)-Avi-tagged | +Inquiry |
CUL3-1097R | Recombinant Rhesus monkey CUL3 Protein, His-tagged | +Inquiry |
LTK-0999H | Recombinant Human LTK Protein (K450-S864), GST tagged | +Inquiry |
SSP-RS11415-0679S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS11415 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CAT-101B | Active Native Bovine CAT | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
ACHE-8345H | Native Human ACHE | +Inquiry |
MYS-01R | Active Native Rabbit Heavy Meromyosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR2M-5742HCL | Recombinant Human GRINL1A 293 Cell Lysate | +Inquiry |
IL22RA2-2586HCL | Recombinant Human IL22RA2 cell lysate | +Inquiry |
FOLR3-6169HCL | Recombinant Human FOLR3 293 Cell Lysate | +Inquiry |
PCDHB1-3394HCL | Recombinant Human PCDHB1 293 Cell Lysate | +Inquiry |
PLIN2-3107HCL | Recombinant Human PLIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIMI_R710 Products
Required fields are marked with *
My Review for All MIMI_R710 Products
Required fields are marked with *
0
Inquiry Basket