Recombinant Escherichia coli (strain K12) add protein, His-SUMO-tagged
Cat.No. : | add-2482E |
Product Overview : | Recombinant Escherichia coli (strain K12) add protein(P22333)(1-333aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 1-333aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.4 kDa |
AA Sequence : | MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFLTKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVIDGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLFLSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQIGIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGLSREQIRQAQINGLEMAFLSAEEKRALREKVAAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Native Proteins | ||
AsAGP-002B | Native Bovine Asialo-a1-acid glycoprotein Protein | +Inquiry |
IgG-165R | Native Rabbit IgG Fc fragment | +Inquiry |
MB-30275TH | Native Human MB | +Inquiry |
Lysozyme-073H | Native Human Lysozyme Protein | +Inquiry |
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3RA-742CCL | Recombinant Canine IL3RA cell lysate | +Inquiry |
ACSM5-9069HCL | Recombinant Human ACSM5 293 Cell Lysate | +Inquiry |
APBB3-8800HCL | Recombinant Human APBB3 293 Cell Lysate | +Inquiry |
CEACAM6-2797HCL | Recombinant Human CEACAM6 cell lysate | +Inquiry |
C7orf59-7960HCL | Recombinant Human C7orf59 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All add Products
Required fields are marked with *
My Review for All add Products
Required fields are marked with *
0
Inquiry Basket