Recombinant Escherichia coli rzoR protein, His-KSI-tagged
Cat.No. : | rzoR-4068E |
Product Overview : | Recombinant Escherichia coli rzoR protein(P58042)(20-61aa), fused to N-terminal His-KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&KSI |
ProteinLength : | 20-61aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.9 kDa |
AA Sequence : | CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
Col12a1-2817M | Recombinant Mouse Col12a1 protein(140-316aa), His-tagged | +Inquiry |
YLLB-1622B | Recombinant Bacillus subtilis YLLB protein, His-tagged | +Inquiry |
CD14-124H | Recombinant Human CD14 Protein, Fc-tagged | +Inquiry |
SPRY1-6567Z | Recombinant Zebrafish SPRY1 | +Inquiry |
RFL22120MF | Recombinant Full Length Marchantia Polymorpha Putative Atp Synthase Protein Ymf19(Ymf19) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
LH-838H | Active Native Human Luteinizing Hormone | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEAF1-461HCL | Recombinant Human DEAF1 cell lysate | +Inquiry |
PPIL2-2967HCL | Recombinant Human PPIL2 293 Cell Lysate | +Inquiry |
GRAMD4-5759HCL | Recombinant Human GRAMD4 293 Cell Lysate | +Inquiry |
Spleen-662G | Guinea Pig Spleen Lysate, Total Protein | +Inquiry |
NT5C1B-3678HCL | Recombinant Human NT5C1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rzoR Products
Required fields are marked with *
My Review for All rzoR Products
Required fields are marked with *
0
Inquiry Basket