Recombinant Escherichia coli O157:H7 PPIA Protein (25-190 aa), His-SUMO-tagged
Cat.No. : | PPIA-2096E |
Product Overview : | Recombinant Escherichia coli O157:H7 PPIA Protein (25-190 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-190 aa |
Description : | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.1 kDa |
AA Sequence : | AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | ppiA; PPIase A Alternative name(s): Cyclophilin A Rotamase A; |
UniProt ID | P0AFL5 |
◆ Recombinant Proteins | ||
PPIA-60H | Recombinant Human PPIA, His-tagged | +Inquiry |
PPIA-3543R | Recombinant Rhesus monkey PPIA Protein, His-tagged | +Inquiry |
PPIA-8311H | Active Recombinant Human PPIA, His tagged | +Inquiry |
PPIA-4080H | Recombinant Human PPIA protein, His&Myc-tagged | +Inquiry |
PPIA-001H | Recombinant Human PPIA Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIA-2975HCL | Recombinant Human PPIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPIA Products
Required fields are marked with *
My Review for All PPIA Products
Required fields are marked with *
0
Inquiry Basket