Recombinant Enterobacteria phage T4 uvsY Protein, His-SUMO-tagged

• Cat.No.: uvsY-1397H
• Product Overview: Recombinant Enterobacteria phage T4 uvsY Protein (1-137aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: Enterobacteria phage T4
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-137 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 31.8 kDa
• AA Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDG
  DEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: uvsY recombination protein; facilitates UvsX and inhibitor of EndoVII [ Enterobacteria phage T4 ]
• Official Symbol: uvsY
• Synonyms: fdsB; uvsY
• Gene ID: 1258547
• Protein Refseq: NP_049799.2
• UniProt ID: P04537