Recombinant E. coli SSB

• Cat.No.: Ssb-86E
• Product Overview: Recombinant E. coli Single-Stranded DNA-Binding Protein/SSB is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Phe178) of E. coli SSB.

Specification

• Description: Single-Stranded DNA-Binding Protein (SSB) is an essential protein that is present in all organisms ranging from viruses to humans, except Thermoproteales. It is a homotetramer, with each monomer containing one SSB domain. SSB is involved in DNA replication, recombination, and repair. This protein is essential for the replication of the chromosomes and its single-stranded DNA phages. SSB binds to single-stranded regions of DNA to prevent premature annealing, to protect the single-stranded DNA from being digested by nucleases, and to remove secondary structure from the DNA to allow other enzymes to function effectively upon it.
• Source: E. coli
• Species: E. coli
• Form: Lyophilized from a 0.2 μM filtered solution of PBS, pH 7.4
• AA Sequence: MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLA EVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGG QPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Tag: Non