Recombinant E. coli SSB
Cat.No. : | Ssb-86E |
Product Overview : | Recombinant E. coli Single-Stranded DNA-Binding Protein/SSB is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Phe178) of E. coli SSB. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | Non |
Description : | Single-Stranded DNA-Binding Protein (SSB) is an essential protein that is present in all organisms ranging from viruses to humans, except Thermoproteales. It is a homotetramer, with each monomer containing one SSB domain. SSB is involved in DNA replication, recombination, and repair. This protein is essential for the replication of the chromosomes and its single-stranded DNA phages. SSB binds to single-stranded regions of DNA to prevent premature annealing, to protect the single-stranded DNA from being digested by nucleases, and to remove secondary structure from the DNA to allow other enzymes to function effectively upon it. |
Form : | Lyophilized from a 0.2 μM filtered solution of PBS, pH 7.4 |
AA Sequence : | MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLA EVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGG QPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
◆ Recombinant Proteins | ||
SSB-659H | Recombinant Human SSB Protein (Met1-Gln408), His-tagged | +Inquiry |
SSB-30034TH | Recombinant Human SSB, His-tagged | +Inquiry |
SSB-1422M | Recombinant Mouse SSB Protein, His-tagged | +Inquiry |
SSB-9952Z | Recombinant Zebrafish SSB | +Inquiry |
SSB-2258H | Recombinant Human SSB protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSB-1466HCL | Recombinant Human SSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ssb Products
Required fields are marked with *
My Review for All Ssb Products
Required fields are marked with *
0
Inquiry Basket