Recombinant E. coli fimH Protein

Cat.No. : fimH-16E
Product Overview : Recombinant E. coli fimH Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Description : type 1 fimbriae D-mannose specific adhesin
Form : Liquid. In 1 x PBS, pH 7.4.
Molecular Mass : ~29.1 kDa
AA Sequence : FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Endotoxin : Removed (9.31mg).
Purity : >90%
Storage : Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.3 mg/ml
Official Full Name : Type 1 fimbriae D-mannose specific adhesin
Gene Name fimH type 1 fimbriae D-mannose specific adhesin [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol fimH
Synonyms ECK4311; pilE
Gene ID 948847
Protein Refseq NP_418740
UniProt ID P08191

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All fimH Products

Required fields are marked with *

My Review for All fimH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon