Creative BioMart to Present at BPS 2025 Annual Meeting | February 15-19, 2025

Recombinant Domestic water buffalo Lingual protein, His-KSI-tagged

Cat.No. : Lingual-4275D
Product Overview : Recombinant Domestic water buffalo Lingual protein(A3RJ36)(25-64aa), fused to N-terminal His-KSI tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Domestic water buffalo
Tag : His&KSI
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 19.8 kDa
Protein length : 25-64aa
AA Sequence : VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Lingual Products

Required fields are marked with *

My Review for All Lingual Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2025 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends