Recombinant Dog ANGPT2 protein(19-495aa), His-tagged

Cat.No. : ANGPT2-2938D
Product Overview : Recombinant Dog ANGPT2 protein(A0A8J8)(19-495aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : HEK293
Tag : His
Protein Length : 19-495aa
Form : Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Dog ANGPT2 at 2 μg/mL can bind anti-ANGPT2 recombinant antibody, the EC50 is 2.836-4.992 ng/mL.
Molecular Mass : 57.2 kDa
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF
Gene Name ANGPT2 angiopoietin 2 [ Canis lupus familiaris ]
Official Symbol ANGPT2
Synonyms ANGPT2; angiopoietin 2; angiopoietin-2; ANG-2;
Gene ID 607616
mRNA Refseq NM_001048126
Protein Refseq NP_001041591

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANGPT2 Products

Required fields are marked with *

My Review for All ANGPT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon