Recombinant Dengue flavivirus polyprotein gene protein

• Cat.No.: flavivirus polyprotein gene-40D
• Product Overview: The E.Coli derived recombinant protein contains the NS1 Dengue Virus c-end Type-2 immunodominant regions.

Specification

• Species: DENV
• Source: E.coli
• Tag: Non
• Description: Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
• Form: 20mM Tris-HCl pH 8.0, 8M urea & 60mM NaCl.
• AA sequence: LWSNGVLESEMVIPKNFAGPKSQHNNRPGYHTQTAGPWHLGKLEMDFDFCEGTTVVVTEDCGNRGPSLRTTTASGKLITEWCCRSCTLPPLRYRGEDGCWYGMEIRPLKEKEENLVSSLVTAHHHHHH
• Purity: Dengue Protein is >90% pure as determined by 10% PAGE (coomassie staining).
• Applications: Each laboratory should determine an optimum working titer for use in its particular application.
• Usage: The products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
• Storage: Dengue although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
• Shipping: Ice Packs

Gene Information

• Gene Name: flavivirus polyprotein gene flavivirus polyprotein [ Dengue virus 2 ]
• Official Symbol: flavivirus polyprotein gene
• Synonyms: flavivirus polyprotein gene; flavivirus polyprotein; anchored capsid protein C; capsid protein C; membrane glycoprotein precursor M; membrane glycoprotein M; envelope protein E; nonstructural protein NS1; nonstructural protein NS2A; nonstructural protein NS2B; nonstructural protein NS3; nonstructural protein NS4A; protein 2K; nonstructural protein NS4B; RNA-dependent RNA polymerase NS5; protein pr
• Gene ID: 1494449
• Protein Refseq: NP_056776.2
• UniProt ID: A0A173DS53