Recombinant Dengue flavivirus polyprotein gene protein
Cat.No. : | flavivirus polyprotein gene-40D |
Product Overview : | The E.Coli derived recombinant protein contains the NS1 Dengue Virus c-end Type-2 immunodominant regions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | DENV |
Source : | E.coli |
Tag : | Non |
Description : | Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus. |
Form : | 20mM Tris-HCl pH 8.0, 8M urea & 60mM NaCl. |
AA sequence : | LWSNGVLESEMVIPKNFAGPKSQHNNRPGYHTQTAGPWHLGKLEMDFDFCEGTTVVVTEDCGNRGPSLRTTTASGKLITEWCCRSCTLPPLRYRGEDGCWYGMEIRPLKEKEENLVSSLVTAHHHHHH |
Purity : | Dengue Protein is >90% pure as determined by 10% PAGE (coomassie staining). |
Applications : | Each laboratory should determine an optimum working titer for use in its particular application. |
Usage : | The products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
Storage : | Dengue although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
Shipping : | Ice Packs |
Gene Name | flavivirus polyprotein gene flavivirus polyprotein [ Dengue virus 2 ] |
Official Symbol | flavivirus polyprotein gene |
Synonyms | flavivirus polyprotein gene; flavivirus polyprotein; anchored capsid protein C; capsid protein C; membrane glycoprotein precursor M; membrane glycoprotein M; envelope protein E; nonstructural protein NS1; nonstructural protein NS2A; nonstructural protein NS2B; nonstructural protein NS3; nonstructural protein NS4A; protein 2K; nonstructural protein NS4B; RNA-dependent RNA polymerase NS5; protein pr |
Gene ID | 1494449 |
Protein Refseq | NP_056776.2 |
UniProt ID | A0A173DS53 |
◆ Recombinant Proteins | ||
flavivirus polyprotein gene-293Z | Recombinant Zika flavivirus polyprotein gene protein, His-tagged | +Inquiry |
flavivirus polyprotein gene-296Z | Recombinant Zika (MR-766) flavivirus polyprotein gene protein, His-tagged | +Inquiry |
flavivirus polyprotein gene-41D | Recombinant Dengue flavivirus polyprotein gene protein, GST-tagged | +Inquiry |
flavivirus polyprotein gene-292Z | Recombinant Zika flavivirus polyprotein gene protein, His-tagged | +Inquiry |
flavivirus polyprotein gene-43D | Recombinant Dengue flavivirus polyprotein gene protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All flavivirus polyprotein gene Products
Required fields are marked with *
My Review for All flavivirus polyprotein gene Products
Required fields are marked with *
0
Inquiry Basket