Recombinant Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E, His-Myc-tagged
Cat.No. : | E-3642D |
Product Overview : | Recombinant Dendroaspis polylepis polylepis E protein(P00984)(1-59aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dendroaspis polylepis polylepis |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-59aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 14.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LQHRTFCKLPAEPGPCKASIPAFYYNWAAKKCQLFHYGGCKGNANRFSTIEKCRHACVG |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All E Products
Required fields are marked with *
My Review for All E Products
Required fields are marked with *
0
Inquiry Basket