Recombinant Cynomolgus Monkey IL21 Protein
Cat.No. : | IL21-02C |
Product Overview : | Recombinant Cynomolgus Monkey IL21 Protein was expressed in HEK293. |
Availability | April 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Description : | interleukin 21 |
Form : | Lyophilized from sterile PBS, pH 7.4, 5 % trehalose, 5 % mannitol. |
Molecular Mass : | ~18.6 kDa |
AA Sequence : | MGWSCIILFLVATATGVHSHHHHHHGGGGSQGQDRHMIRMRQLIDIVDQLKNYVNDLDPEFLPAPEDVETNCEWSAISCFQKAQLKSANTGNNERIINLSIKKLKRKSPSTGAERRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Purity : | >90% as determined by SDS-PAGE |
Storage : | Please prepare aliquots and store at -20 to 80 centigrade. Avoid freeze/thaw cycles. |
Gene Name | IL21 interleukin 21 [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | IL21 |
Gene ID | 708125 |
mRNA Refseq | NM_001194242.1 |
Protein Refseq | NP_001181171.1 |
UniProt ID | A0A2K5UL71 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Products
Required fields are marked with *
My Review for All Products
Required fields are marked with *
0
Inquiry Basket