Recombinant Cynomolgus monkey CD80 Protein, Fc-tagged

• Cat.No.: CD80-587C
• Product Overview: Recombinant Cynomolgus monkey CD80 protein with Fc tag was expressed in HEK293.

Specification

• Description: The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy.
• Source: HEK293
• Species: Cynomolgus monkey
• Tag: Fc
• Form: Lyophilized
• Molecular Mass: 50.5 kDa
• Protein length: 288
• AA Sequence: MGHTWRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNETLRRESVRPI
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CD80 CD80 molecule [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: CD80
• Synonyms: CD80; CD80 molecule; T-lymphocyte activation antigen CD80; B7.1
• Gene ID: 732518
• mRNA Refseq: NM_001042642
• Protein Refseq: NP_001036107
• UniProt ID: A0A8J8YFK0