Recombinant cd80 Proteins
- Product List
- Specification
- Gene Information
- Cat. #
- Tag
- Source (Host)
- Species
- Protein Length
- Price
- Datasheet
| Source : | Human cells |
| Species : | Human |
| Tag : | His |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Binds human CD28, CTLA4 and PD-L1. Induces IL-2 secretion in human T cells. |
| Molecular Mass : | Calculated molecular mass 25.3 kDa; estimated by SDS-PAGE under reducing condition 45-55 kDa probably due to glycosylation. |
| AA Sequence : | VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRP SDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEEL NAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSTGHHHHHHHH |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Protein length : | 35-242 a.a. |
| Gene Name | CD80 CD80 molecule [ Homo sapiens ] |
| Official Symbol | CD80 |
| Synonyms | CD80; CD80 molecule; CD28LG, CD28LG1, CD80 antigen (CD28 antigen ligand 1, B7 1 antigen) , CD80 molecule; T-lymphocyte activation antigen CD80; B lymphocyte activation antigen B7; B7 1; B7.1; activation B7-1 antigen; costimulatory factor CD80; CTLA-4 counter-receptor B7.1; B-lymphocyte activation antigen B7; costimulatory molecule variant IgV-CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); B7; BB1; B7-1; LAB7; CD28LG; CD28LG1; |
| Gene ID | 941 |
| mRNA Refseq | NM_005191 |
| Protein Refseq | NP_005182 |
| MIM | 112203 |
| UniProt ID | P33681 |
| Chromosome Location | 3q13.3-q21 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem; |
| Function | coreceptor activity; protein binding; receptor activity; |
