Recombinant Cynodon Dactylon PRO1 Protein (2-131 aa), His-SUMO-tagged

• Cat.No.: PRO1-1922C
• Product Overview: Recombinant Cynodon Dactylon (Bermuda grass) (Panicum dactylon) PRO1 Protein (2-131 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Cynodon Dactylon
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 2-131 aa
• Description: Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 30.0 kDa
• AA Sequence: SWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: PRO1; Pollen allergen Cyn d 12 Allergen: Cyn d 12
• UniProt ID: O04725