Recombinant CXCL2 Protein, His-Flag-StrepII-tagged
Cat.No. : | CXCL2-2165P |
Product Overview : | Purified CXCL2 (NP_002080.1, 35 a.a. - 107 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Flag&His&Strep II |
Protein Length : | 35-107 a.a. |
Description : | This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014] |
Form : | Liquid |
Bio-activity : | Not Tested |
Molecular Mass : | 13.31 kDa |
AA Sequence : | APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
Applications : | Western Blot Enzyme-linked Immunoabsorbent Assay SDS-PAGE Protein Interaction |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 μg/ml |
Storage Buffer : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Gene Name | CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ] |
Official Symbol | CXCL2 |
Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a; |
Gene ID | 2920 |
mRNA Refseq | NM_002089 |
Protein Refseq | NP_002080 |
MIM | 139110 |
UniProt ID | P19875 |
◆ Recombinant Proteins | ||
CXCL2-2100H | Recombinant Human CXCL2 Protein (Thr39-Asn107), C-His tagged | +Inquiry |
Cxcl2-2395M | Active Recombinant Mouse Cxcl2 Protein | +Inquiry |
Cxcl2-626R | Active Recombinant Rat Cxcl2 | +Inquiry |
CXCL2-476H | Recombinant Human CXCL2 protein | +Inquiry |
Cxcl2-38M | Recombinant Mouse Chemokine (C-X-C Motif) Ligand 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL2 Products
Required fields are marked with *
My Review for All CXCL2 Products
Required fields are marked with *
0
Inquiry Basket