Recombinant COVID-19 ORF8 Protein(16-121aa), His-tagged

• Cat.No.: ORF8-3928V
• Product Overview: Recombinant COVID-19 ORF8 Protein(16-121aa)(P0DTC8), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: COVID-19
• Source: E.coli
• Tag: His
• ProteinLength: 16-121aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 16.3 kDa
• AA Sequence: FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.