Recombinant Chicken IL2 Protein, Biotinylated Conjugated

• Cat.No.: IL2-03C
• Product Overview: The Chicken IL-2 recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specification

• Species: Chicken
• Source: Yeast
• Description: Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. IL-2 was discovered to be a member of a family of cytokines, which also includes IL-4, IL-7, IL-9, IL-15 and IL-21. IL-2 signals through a receptor complex consisting of IL-2 specific IL-2 receptor alpha (CD25), IL-2 receptor beta (CD122) and a common gamma chain (γc). All members of this family use the common gamma chain as part of their signaling complex.
• Molecular Mass: 14.0 kDa
• AA Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK(121)
• Applications: The Chicken IL-2 endotoxin-free recombinant protein can be used in cell culture.

Gene Information

• Gene Name: IL2 interleukin 15 [ Gallus gallus (chicken) ]
• Official Symbol: IL2
• Synonyms: IL2; interleukin 2; IL-2; interleukin-2
• Gene ID: 373958
• mRNA Refseq: NM_204153
• Protein Refseq: NP_989484
• UniProt ID: O42288