Recombinant Cenarchaeum Symbiosum POLC Protein (287-832 aa)

• Cat.No.: POLC-2172C
• Product Overview: Recombinant Cenarchaeum Symbiosum (strain A) POLC Protein (287-832 aa) is produced by E. coli expression system. Protein Description: Partial.

Specification

• Species: Cenarchaeum Symbiosum
• Source: E.coli
• Tag: Non
• Protein Length: 287-832 aa
• Description: Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 59.0 kDa
• AA Sequence: LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRCWACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQEKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDATNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIPLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: polC
• UniProt ID: A0RYM0