Recombinant Cattle RETN Protein, His-tagged

• Cat.No.: RETN-1351C
• Product Overview: Recombinant Cattle RETN Protein (19-109aa) was expressed in E. coli with N-terminal His tag.

Specification

• Species: Cattle
• Source: E.coli
• Tag: His
• ProteinLength: 19-109 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 13.6 kDa
• AA Sequence: QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETT
  CHCQCAGMDWTGARCCRLHIQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: RETN resistin [ Bos taurus (cattle) ]
• Official Symbol: RETN
• Synonyms: RETN; RSTN; resistin; adipocyte specific secreted hormone
• Gene ID: 369020
• mRNA Refseq: NM_183362.1
• Protein Refseq: NP_899206.1
• UniProt ID: Q762I5