Recombinant Canine IL-1 beta
Cat.No. : | Il1b-25C |
Product Overview : | Canine IL-1 beta was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Canine |
Source : | Yeast |
Tag : | Non |
Description : | The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α (IL-1F1), IL-1β (IL-1F2), and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an "alarmin" released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation. |
Form : | Lyophilized |
Molecular Mass : | 17.5 kDa |
AA Sequence : | AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKD GKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEF SS |
Applications : | The Canine IL-1 beta protein can be used in cell culture, as an IL-1 beta ELISA Standard, and as a Western Blot Control. |
Storage : | -20 C |
◆ Recombinant Proteins | ||
IL1b-56O | Recombinant Ovine IL-1 beta | +Inquiry |
Il1B-466H | Recombinant Human Il1B, HIgG1 Fc-tagged | +Inquiry |
il1b-2298Z | Recombinant Zebrafish il1b Protein, His-tagged | +Inquiry |
IL1B-02H | Recombinant Human IL1B protein | +Inquiry |
IL1B-577R | Recombinant Rat IL1B, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il1b Products
Required fields are marked with *
My Review for All Il1b Products
Required fields are marked with *
0
Inquiry Basket