Recombinant Bovine RBP3 Protein (933-1231 aa), GST-tagged

• Cat.No.: RBP3-2329B
• Product Overview: Recombinant Bovine RBP3 Protein (933-1231 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Bovine
• Source: E.coli
• Tag: GST
• Protein Length: 933-1231 aa
• Description: IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 59.5 kDa
• AA Sequence: AKVPTVLQTAGKLVADNYASPELGVKMAAELSGLQSRYARVTSEAALAELLQADLQVLSGDPHLKTAHIPEDAKDRIPGIVPMQIPSPEVFEDLIKFSFHTNVLEGNVGYLRFDMFGDCELLTQVSELLVEHVWKKIVHTDALIVDMRFNIGGPTSSISALCSYFFDEGPPILLDKIYNRPNNSVSELWTLSQLEGERYGSKKSMVILTSTLTAGAAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTDLYLTIPTARSVGAADGSSWEGVGVVPDVAVPAEAALTRAQEMLQHT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: RBP3 retinol binding protein 3 [ Bos taurus (cattle) ]
• Official Symbol: RBP3
• Synonyms: RBP3
• Gene ID: 281443
• mRNA Refseq: NM_174164
• Protein Refseq: NP_776589
• UniProt ID: P12661