Recombinant Bovine RBP3 Protein (933-1231 aa), GST-tagged

Cat.No. : RBP3-2329B
Product Overview : Recombinant Bovine RBP3 Protein (933-1231 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : E.coli
Tag : GST
Protein Length : 933-1231 aa
Description : IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 59.5 kDa
AA Sequence : AKVPTVLQTAGKLVADNYASPELGVKMAAELSGLQSRYARVTSEAALAELLQADLQVLSGDPHLKTAHIPEDAKDRIPGIVPMQIPSPEVFEDLIKFSFHTNVLEGNVGYLRFDMFGDCELLTQVSELLVEHVWKKIVHTDALIVDMRFNIGGPTSSISALCSYFFDEGPPILLDKIYNRPNNSVSELWTLSQLEGERYGSKKSMVILTSTLTAGAAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTDLYLTIPTARSVGAADGSSWEGVGVVPDVAVPAEAALTRAQEMLQHT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name RBP3 retinol binding protein 3 [ Bos taurus (cattle) ]
Official Symbol RBP3
Synonyms RBP3;
Gene ID 281443
mRNA Refseq NM_174164
Protein Refseq NP_776589
UniProt ID P12661

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RBP3 Products

Required fields are marked with *

My Review for All RBP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon